DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:120 Identity:36/120 - (30%)
Similarity:48/120 - (40%) Gaps:29/120 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LQVLAIMNGIDMEIEVPEASKRAILELP------------VHEIVKSDEGGDL------------ 68
            :|.|||...| ........::|.|.:||            ..||..|.:.|:|            
pombe   253 VQALAIRKFI-RTYRTKSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRAT 316

  Fly    69 ---ECSVCKEPAEEGQKYRILPCKHEFHEECILLWL-KKTNSCPLCRYELETDDP 119
               ||.:|.|...:|.|...||||||||..||..|: ...::||.|..|:....|
pombe   317 FGVECVICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTEVPPPKP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 19/42 (45%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 35/116 (30%)
Peptidases_S8_S53 <144..211 CDD:299169
zf-RING_2 320..362 CDD:290367 19/41 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1776
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.