DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and Ark2c

DIOPT Version :10

Sequence 1:NP_650729.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001157976.1 Gene:Ark2c / 225743 MGIID:2444521 Length:347 Species:Mus musculus


Alignment Length:116 Identity:38/116 - (32%)
Similarity:54/116 - (46%) Gaps:18/116 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FEELGHEPTGPLGANDLARNLKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDEG---- 65
            :|||       |...|...|:.|   .|:.|.|: ....|...|:   ..|.....|.|||    
Mouse   240 YEEL-------LQLEDRLGNVTR---GAVQNTIE-RFTFPHKYKK---RRPQDSKGKKDEGEESD 290

  Fly    66 GDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELET 116
            .|.:|::|....|:|:..|.|||.|.||:.|:..||..:..||:||.::||
Mouse   291 TDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIET 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_650729.1 PEX10 <18..111 CDD:227861 30/96 (31%)
RING-H2_RNF181 69..114 CDD:438331 18/44 (41%)
Ark2cNP_001157976.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..79
Ubiquitin binding. /evidence=ECO:0000250|UniProtKB:Q6ZSG1 267..269 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..289 7/23 (30%)
RING-H2_RNF165 286..344 CDD:438344 22/56 (39%)
Ubiquitin binding. /evidence=ECO:0000250|UniProtKB:Q6ZSG1 310..314 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.