DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and Pja2

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001020480.1 Gene:Pja2 / 224938 MGIID:2159342 Length:707 Species:Mus musculus


Alignment Length:90 Identity:32/90 - (35%)
Similarity:48/90 - (53%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIVKSDE---GGDLECSVCKEPAEEGQKYRIL 86
            |..|:.||    :|:|:..|.|||.:|..|| ..:|..|.   |.:..|.:|.....:......|
Mouse   590 LAHLESLA----VDVEVANPPASKESIDGLP-ETLVLEDHTAIGQEQCCPICCSEYIKDDIATEL 649

  Fly    87 PCKHEFHEECILLWLKKTNSCPLCR 111
            ||.|.||:.|:.:||:|:.:||:||
Mouse   650 PCHHFFHKPCVSIWLQKSGTCPVCR 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 14/41 (34%)
Pja2NP_001020480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..314
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..405
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..493
Interaction with PRKAR1A, PRKAR2A and PRKAR2B. /evidence=ECO:0000250 530..707 32/90 (36%)
zf-RING_2 633..674 CDD:290367 14/40 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.