DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7694 and Rnf43

DIOPT Version :9

Sequence 1:	NP_001138076.1	Gene:	CG7694 / 42230	FlyBaseID:	FBgn0038627	Length:	147	Species:	Drosophila melanogaster
Sequence 2:	NP_766036.2	Gene:	Rnf43 / 207742	MGIID:	2442609	Length:	784	Species:	Mus musculus

Alignment Length:	99	Identity:	32/99 - (32%)
Similarity:	44/99 - (44%)	Gaps:	24/99 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    48 KRAILELPVHEIVKSDEGGDLE----CSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCP 108
            :||..|.|       |.|....    |::|.|...|||:.|::.|.||||..|:..||.:..:||
Mouse   253 RRARAEWP-------DSGSSCSSTPVCAICLEEFSEGQELRVISCLHEFHRTCVDPWLYQHRTCP 310

  Fly   109 LCRYELETDD---------PVYEE----LRRFRQ 129
            ||.:.:...|         |.|:|    |...||
Mouse   311 LCMFNIVEGDSFSQAPAASPSYQEPGRRLHLIRQ 344

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7694	NP_001138076.1	zf-RING_2	69..111	CDD:290367	18/45 (40%)
Rnf43	NP_766036.2	zf-RING_2	270..312	CDD:290367	17/41 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	364..407
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	459..478
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	516..671
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910