DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and C01G6.4

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001379057.1 Gene:C01G6.4 / 182077 WormBaseID:WBGene00007226 Length:170 Species:Caenorhabditis elegans


Alignment Length:107 Identity:33/107 - (30%)
Similarity:52/107 - (48%) Gaps:27/107 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EVPEASK---RAILELPVHEIVKSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKK 103
            |:.||.|   |.:||....::.:.|...: ||::|....|.|::.|.|||.|.||:||:..||.|
 Worm    65 ELDEAKKNRIRGLLEQIPADVFRGDMTSN-ECAICMIDFEPGERIRFLPCMHSFHQECVDEWLMK 128

  Fly   104 TNSCPLCRYELETDDPVYEELRRFRQDEANRRERENTLLDSM 145
            :.:||.|.      :||                 ::|:|.|:
 Worm   129 SFTCPSCL------EPV-----------------DSTILSSL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 19/41 (46%)
C01G6.4NP_001379057.1 RING-H2_RNF11 94..136 CDD:319382 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.