DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7694 and ZK637.14

DIOPT Version :9

Sequence 1:NP_001138076.1 Gene:CG7694 / 42230 FlyBaseID:FBgn0038627 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_498962.1 Gene:ZK637.14 / 176251 WormBaseID:WBGene00014031 Length:161 Species:Caenorhabditis elegans


Alignment Length:102 Identity:33/102 - (32%)
Similarity:46/102 - (45%) Gaps:30/102 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DLECSVC----------------KE-----PAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLC 110
            |..|::|                ||     |...|....::||||.||..|:.|||:...:||.|
 Worm    69 DATCAICLDNLQNNVDIPEDHVIKEELKIDPTTFGTTVIVMPCKHRFHYFCLTLWLEAQQTCPTC 133

  Fly   111 RYELETDDPVYEELRRFRQDEANRRERENTLLDSMFG 147
            |.:::||..|.||.|:...:|         |.|||:|
 Worm   134 RQKVKTDKEVEEEERQRNLEE---------LHDSMYG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7694NP_001138076.1 zf-RING_2 69..111 CDD:290367 18/62 (29%)
ZK637.14NP_498962.1 zf-rbx1 <68..134 CDD:289448 19/64 (30%)
zf-RING_2 71..134 CDD:290367 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.