DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEOX2 and Ubx

DIOPT Version :9

Sequence 1:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:243 Identity:68/243 - (27%)
Similarity:90/243 - (37%) Gaps:74/243 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   105 RHSLCLQPD---------SGGPP------ELGSSPPVLCSNSSS---------LGSSTPTGAACA 145
            |.|.| .||         |||.|      ..|.:..|...|.::         .|:.|...|.|.
  Fly   154 RPSAC-TPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCT 217

Human   146 PGDYGRQALS-------------------------PAEAEKRSG-----------GKRKSDSSDS 174
            ......|..:                         |.:::.||.           |||   .|:|
  Fly   218 ISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKR---YSES 279

Human   175 QEGNYKSE---VNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQ 236
            ..|:...:   .|...|:.|..:|:.|..|||.||..::||||.||.|:|..|.|||||:|:|||
  Fly   280 LAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQ 344

Human   237 NRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTG 284
            |||||.|:       .....|||...:|........:...||...|.|
  Fly   345 NRRMKLKK-------EIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 28/149 (19%)
COG5576 160..284 CDD:227863 49/137 (36%)
Homeobox 191..243 CDD:278475 31/51 (61%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.