Sequence 1: | NP_005915.2 | Gene: | MEOX2 / 4223 | HGNCID: | 7014 | Length: | 304 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536752.1 | Gene: | Ubx / 42034 | FlyBaseID: | FBgn0003944 | Length: | 389 | Species: | Drosophila melanogaster |
Alignment Length: | 243 | Identity: | 68/243 - (27%) |
---|---|---|---|
Similarity: | 90/243 - (37%) | Gaps: | 74/243 - (30%) |
- Green bases have known domain annotations that are detailed below.
Human 105 RHSLCLQPD---------SGGPP------ELGSSPPVLCSNSSS---------LGSSTPTGAACA 145
Human 146 PGDYGRQALS-------------------------PAEAEKRSG-----------GKRKSDSSDS 174
Human 175 QEGNYKSE---VNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQ 236
Human 237 NRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTG 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MEOX2 | NP_005915.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 63..192 | 28/149 (19%) | |
COG5576 | 160..284 | CDD:227863 | 49/137 (36%) | ||
Homeobox | 191..243 | CDD:278475 | 31/51 (61%) | ||
Ubx | NP_536752.1 | Homeobox | 299..352 | CDD:395001 | 31/52 (60%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |