DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEOX2 and ftz

DIOPT Version :9

Sequence 1:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:173 Identity:57/173 - (32%)
Similarity:74/173 - (42%) Gaps:48/173 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    82 QQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG-SSPPVLCSNSSSLGSS-------- 137
            |.|.|.|:..    ..::||.....||        ||..| |:||......||...|        
  Fly   177 QSQTQKLKNG----DFATPPPTTPTSL--------PPLEGISTPPQSPGEKSSSAVSQEINHRIV 229

Human   138 -TPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE 201
             .|.||    ||:....:....|         ||..||             ::.|..:|:.|..|
  Fly   230 TAPNGA----GDFNWSHIEETLA---------SDCKDS-------------KRTRQTYTRYQTLE 268

Human   202 LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 244
            ||.||..:.|:||.||.:||..|.|:|||:|:||||||||.|:
  Fly   269 LEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 27/119 (23%)
COG5576 160..284 CDD:227863 34/85 (40%)
Homeobox 191..243 CDD:278475 29/51 (57%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 22/86 (26%)
Homeobox 257..310 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.