DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEOX2 and Scr

DIOPT Version :9

Sequence 1:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:370 Identity:88/370 - (23%)
Similarity:125/370 - (33%) Gaps:133/370 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    20 HPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHH--------- 75
            |..:|::....|..|.:.|.:|             ..:.:...|..:.....|.|.         
  Fly    94 HYANQAAYGGQGNPDMVDYTQL-------------QPQRLLLQQQQQQQQQQHAHAAAAVAAQQQ 145

Human    76 ---HHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGG--------------------- 116
               ....|.|||.|..|.|......:.|.:..        .|||                     
  Fly   146 QQLAQQQHPQQQQQQQQANISCKYANDPVTPG--------GSGGGGVSGSNNNNNSANSNNNNSQ 202

Human   117 ----PPELGS---SPPVLCS----------NSSSLGSSTPTGAACA--------------PGDYG 150
                |.:|.:   ||.:..|          |...||.|....||.|              ||:..
  Fly   203 SLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVN 267

Human   151 RQALSPAEAEKRSGGKRKSDSSDSQ-EGNYKS-------------------EVNSKPRKERTAFT 195
            ....||...:..|.....:::..|| .||.|.                   ..|.:.:::||::|
  Fly   268 VPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYT 332

Human   196 KEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELV 260
            :.|..|||.||..:.||||.||.|||..|.|||||:|:||||||||||           :|.::.
  Fly   333 RYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK-----------KEHKMA 386

Human   261 NVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSD-HSSEHAHL 304
            ::   .::|..:...|             ...|..| |.|:.|||
  Fly   387 SM---NIVPYHMGPYG-------------HPYHQFDIHPSQFAHL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 37/212 (17%)
COG5576 160..284 CDD:227863 45/143 (31%)
Homeobox 191..243 CDD:278475 33/51 (65%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 35/63 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.