DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7691 and SCRT2

DIOPT Version :9

Sequence 1:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	NP_149120.1	Gene:	SCRT2 / 85508	HGNCID:	15952	Length:	307	Species:	Homo sapiens

Alignment Length:	136	Identity:	54/136 - (39%)
Similarity:	70/136 - (51%)	Gaps:	21/136 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   143 KQTR----TKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQFECIDCDKKFDHSWM 203
            |||.    ::|.||.|     |.....|.:|.:....:....|.|       |..|.|.|...|:
Human   174 KQTHRSLDSQLARKCP-----TCGKAYVSMPALAMHLLTHNLRHK-------CGVCGKAFSRPWL 226

  Fly   204 LTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHEWQH-QCGQCGKYFSQFSYLNRHS 267
            |..|.|:|||||||.|  ..|.|||:||||||:|.:|  |..::| :|.||.|.|:..|||::|.
Human   227 LQGHMRSHTGEKPFGC--AHCGKAFADRSNLRAHMQT--HSAFKHYRCRQCDKSFALKSYLHKHC 287

  Fly   268 LDACRK 273
            ..||.|
Human   288 EAACAK 293

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	39/83 (47%)
		C2H2 Zn finger	191..211	CDD:275368	8/19 (42%)
		zf-H2C2_2	203..229	CDD:290200	14/25 (56%)
		C2H2 Zn finger	219..244	CDD:275368	13/24 (54%)
		C2H2 Zn finger	250..266	CDD:275368	8/15 (53%)
SCRT2	NP_149120.1	SNAG domain. /evidence=ECO:0000250	1..20
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	34..90
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	116..148
		C2H2 Zn finger	157..177	CDD:275368	2/2 (100%)
		COG5048	<210..>277	CDD:227381	36/77 (47%)
		C2H2 Zn finger	214..234	CDD:275368	8/19 (42%)
		zf-H2C2_2	227..250	CDD:290200	14/24 (58%)
		C2H2 Zn finger	242..262	CDD:275368	13/23 (57%)
		zf-H2C2_2	254..278	CDD:290200	11/25 (44%)
		C2H2 Zn finger	270..286	CDD:275368	8/15 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810