DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and ADR1

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_010502.3 Gene:ADR1 / 851802 SGDID:S000002624 Length:1323 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:53/224 - (23%)
Similarity:79/224 - (35%) Gaps:69/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VKFTYCFG---QSEPSGDWRQGDDIPIVVRREMEERLGIQLMSVLPITESSLLSHTIWELKMPGE 119
            |....||.   .:|......:.||.||:            |||.....|:|             .
Yeast    16 VDLNSCFSNGFNNEKQEIEMETDDSPIL------------LMSSSASRENS-------------N 55

  Fly   120 SFDSIPKTRNGIKVGIITVTAESKQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRL-- 182
            :|..|.:|.:|   .|||.   :....:|:.:                    |..|:||..||  
Yeast    56 TFSVIQRTPDG---KIITT---NNNMNSKINK--------------------QLDKLPENLRLNG 94

  Fly   183 KRVGGQ---FECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHH 244
            :...|:   |.|..|.:.|.....|..|.|:||.|||:.|  |.|.:.|:.|..|..|.:.:   
Yeast    95 RTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPC--GLCNRCFTRRDLLIRHAQKI--- 154

  Fly   245 EWQHQCGQCGKYFSQFSYLNRHSLDACRK 273
                ..|..|:..|....::| ::...||
Yeast   155 ----HSGNLGETISHTKKVSR-TITKARK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 23/85 (27%)
C2H2 Zn finger 191..211 CDD:275368 6/19 (32%)
zf-H2C2_2 203..229 CDD:290200 11/25 (44%)
C2H2 Zn finger 219..244 CDD:275368 7/24 (29%)
C2H2 Zn finger 250..266 CDD:275368 3/15 (20%)
ADR1NP_010502.3 zf-C2H2 104..126 CDD:395048 7/21 (33%)
C2H2 Zn finger 106..126 CDD:275368 6/19 (32%)
zf-H2C2_2 118..143 CDD:404364 12/26 (46%)
C2H2 Zn finger 134..155 CDD:275368 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.