DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7691 and snai1b

DIOPT Version :9

Sequence 1:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	NP_571064.2	Gene:	snai1b / 792194	ZFINID:	ZDB-GENE-980526-514	Length:	256	Species:	Danio rerio

Alignment Length:	82	Identity:	41/82 - (50%)
Similarity:	54/82 - (65%)	Gaps:	5/82 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   191 CIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHE-WQHQCGQCG 254
            |..|.|.|...|:|..|.||||||:||.||  .|.:||:||||||:|.:|  |.| .::|||.|.
Zfish   175 CSTCGKAFSRPWLLRGHIRTHTGERPFSCP--HCNRAFADRSNLRAHLQT--HSEVKKYQCGSCS 235

  Fly   255 KYFSQFSYLNRHSLDAC 271
            :.||:.|.|::|:|..|
Zfish   236 RTFSRMSLLHKHTLSGC 252

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	40/80 (50%)
		C2H2 Zn finger	191..211	CDD:275368	8/19 (42%)
		zf-H2C2_2	203..229	CDD:290200	14/25 (56%)
		C2H2 Zn finger	219..244	CDD:275368	13/24 (54%)
		C2H2 Zn finger	250..266	CDD:275368	7/15 (47%)
snai1b	NP_571064.2	C2H2 Zn finger	149..169	CDD:275368
		C2H2 Zn finger	175..195	CDD:275368	8/19 (42%)
		zf-H2C2_2	188..211	CDD:316026	14/24 (58%)
		zf-C2H2	201..223	CDD:306579	14/25 (56%)
		C2H2 Zn finger	203..223	CDD:275368	13/23 (57%)
		C2H2 Zn finger	231..247	CDD:275368	7/15 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900