DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7691 and ZBTB16

DIOPT Version :9

Sequence 1:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	NP_001018011.1	Gene:	ZBTB16 / 7704	HGNCID:	12930	Length:	673	Species:	Homo sapiens

Alignment Length:	79	Identity:	31/79 - (39%)
Similarity:	41/79 - (51%)	Gaps:	9/79 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   191 CIDCDKKFDHSWMLTAHTRTHTGEKPFVCP-DGSCRKAFSDRSNLRSHQRTMGHH--EWQHQCGQ 252
            |.:|::.|.....|..|.|:|||:.|:.|. .|||   |.|.|.|:||:|.   |  |..::|..
Human   520 CSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSC---FRDESTLKSHKRI---HTGEKPYECNG 578

  Fly   253 CGKYFSQFSYLNRH 266
            |||.||....|..|
Human   579 CGKKFSLKHQLETH 592

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	31/79 (39%)
		C2H2 Zn finger	191..211	CDD:275368	6/19 (32%)
		zf-H2C2_2	203..229	CDD:290200	11/26 (42%)
		C2H2 Zn finger	219..244	CDD:275368	11/25 (44%)
		C2H2 Zn finger	250..266	CDD:275368	7/15 (47%)
ZBTB16	NP_001018011.1	BTB	25..125	CDD:306997
		Herpes_ICP4_C	177..>327	CDD:332854
		Interaction with RUNX1T1. /evidence=ECO:0000269\|PubMed:10688654	200..300
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	215..236
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	249..332
		C2H2 Zn finger	406..426	CDD:275368
		C2H2 Zn finger	434..454	CDD:275368
		COG5048	<448..622	CDD:227381	31/79 (39%)
		C2H2 Zn finger	463..483	CDD:275368
		C2H2 Zn finger	492..512	CDD:275368
		C2H2 Zn finger	520..540	CDD:275368	6/19 (32%)
		C2H2 Zn finger	548..568	CDD:275368	11/25 (44%)
		C2H2 Zn finger	576..596	CDD:275368	8/17 (47%)
		C2H2 Zn finger	604..624	CDD:275368
		C2H2 Zn finger	632..652	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100