DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7691 and SNAI1

DIOPT Version :9

Sequence 1:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	NP_005976.2	Gene:	SNAI1 / 6615	HGNCID:	11128	Length:	264	Species:	Homo sapiens

Alignment Length:	82	Identity:	39/82 - (47%)
Similarity:	51/82 - (62%)	Gaps:	5/82 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   191 CIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHE-WQHQCGQCG 254
            |..|.|.|...|:|..|.|||||||||.||  .|.:||:||||||:|.:|  |.: .::||..|.
Human   182 CGTCGKAFSRPWLLQGHVRTHTGEKPFSCP--HCSRAFADRSNLRAHLQT--HSDVKKYQCQACA 242

  Fly   255 KYFSQFSYLNRHSLDAC 271
            :.||:.|.|::|....|
Human   243 RTFSRMSLLHKHQESGC 259

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	38/80 (48%)
		C2H2 Zn finger	191..211	CDD:275368	8/19 (42%)
		zf-H2C2_2	203..229	CDD:290200	15/25 (60%)
		C2H2 Zn finger	219..244	CDD:275368	13/24 (54%)
		C2H2 Zn finger	250..266	CDD:275368	6/15 (40%)
SNAI1	NP_005976.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..27
		SNAG domain. /evidence=ECO:0000305\|PubMed:20389281, ECO:0000305\|PubMed:21300290	1..20
		Required and sufficient for interaction with KDM1A. /evidence=ECO:0000269\|PubMed:20389281, ECO:0000269\|PubMed:23721412	2..7
		LATS2 binding	10..40
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	86..115
		Destruction motif	95..100
		Required for FBXL14-triggered degradation	120..151
		Required for nuclear localization and interaction with KPNB1, NOTCH1 and PARP1. /evidence=ECO:0000269\|PubMed:21577210, ECO:0000269\|PubMed:22128911	151..264		39/82 (48%)
		C2H2 Zn finger	156..176	CDD:275368
		C2H2 Zn finger	182..202	CDD:275368	8/19 (42%)
		zf-H2C2_2	195..218	CDD:404364	15/24 (63%)
		zf-C2H2	208..230	CDD:395048	14/25 (56%)
		C2H2 Zn finger	210..230	CDD:275368	13/23 (57%)
		C2H2 Zn finger	238..255	CDD:275368	6/16 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900