DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and ich

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001262393.1 Gene:ich / 41069 FlyBaseID:FBgn0286204 Length:592 Species:Drosophila melanogaster


Alignment Length:144 Identity:35/144 - (24%)
Similarity:53/144 - (36%) Gaps:46/144 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PKTRNGIKVGIITVTAESKQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQ- 188
            |.|......|....|...|..|::.::|          ||     ..||::..::::....||| 
  Fly   458 PHTTTASTTGSEMRTGAPKAKRSRSQKK----------SN-----QQQQQQQQQQQQQGDGGGQP 507

  Fly   189 ----------------------------FECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCR 225
                                        ..|..|::.|.:...:..|.|||||||||.|  ..|.
  Fly   508 TTPQMSAISPSGFSASDLSGLLGKEKPVHRCSICNRGFLNKSNIKVHLRTHTGEKPFRC--DVCA 570

  Fly   226 KAFSDRSNLRSHQR 239
            |||..:::|..||:
  Fly   571 KAFRQKAHLLKHQQ 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 22/81 (27%)
C2H2 Zn finger 191..211 CDD:275368 5/19 (26%)
zf-H2C2_2 203..229 CDD:290200 14/25 (56%)
C2H2 Zn finger 219..244 CDD:275368 8/21 (38%)
C2H2 Zn finger 250..266 CDD:275368
ichNP_001262393.1 C2H2 Zn finger 538..558 CDD:275368 5/19 (26%)
zf-H2C2_2 550..575 CDD:316026 15/26 (58%)
C2H2 Zn finger 566..586 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.