DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7691 and CG11247

DIOPT Version :9

Sequence 1:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	NP_001097659.1	Gene:	CG11247 / 40414	FlyBaseID:	FBgn0037120	Length:	522	Species:	Drosophila melanogaster

Alignment Length:	85	Identity:	28/85 - (32%)
Similarity:	43/85 - (50%)	Gaps:	1/85 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   189 FECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHEWQHQCGQC 253
            ::|..|.:.|.||.:|..|.|.|||||||.|.......|||..::|::|.:.:...:..:.|..|
  Fly   321 YQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGC 385

  Fly   254 GKYFSQFSYLNRHSLDACRK 273
            ..:|.....|..| ::.|.|
  Fly   386 HDFFKIKVELQSH-VEHCAK 404

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	26/81 (32%)
		C2H2 Zn finger	191..211	CDD:275368	8/19 (42%)
		zf-H2C2_2	203..229	CDD:290200	12/25 (48%)
		C2H2 Zn finger	219..244	CDD:275368	6/24 (25%)
		C2H2 Zn finger	250..266	CDD:275368	4/15 (27%)
CG11247	NP_001097659.1	COG5048	<88..247	CDD:227381
		C2H2 Zn finger	95..115	CDD:275368
		zf-H2C2_2	107..132	CDD:290200
		C2H2 Zn finger	123..144	CDD:275368
		C2H2 Zn finger	152..172	CDD:275368
		zf-H2C2_2	165..189	CDD:290200
		C2H2 Zn finger	180..200	CDD:275368
		COG5048	<192..369	CDD:227381	20/47 (43%)
		C2H2 Zn finger	210..230	CDD:275370
		C2H2 Zn finger	238..260	CDD:275371
		C2H2 Zn finger	267..287	CDD:275368
		C2H2 Zn finger	295..315	CDD:275368
		zf-H2C2_2	309..332	CDD:290200	3/10 (30%)
		C2H2 Zn finger	323..343	CDD:275368	8/19 (42%)
		C2H2 Zn finger	351..374	CDD:275368	6/22 (27%)
		C2H2 Zn finger	382..399	CDD:275368	5/17 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24393
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	2.010