DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and scrt

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster


Alignment Length:132 Identity:48/132 - (36%)
Similarity:64/132 - (48%) Gaps:13/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 KQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQFECIDCDKKFDHSWMLTAH 207
            |||...|..:.....: |.....|.:|.:....:..|.       ...|..|.|.|...|:|..|
  Fly   486 KQTHRSLDSQSAKKCH-TCGKAYVSMPALAMHLLTHKL-------SHSCGVCGKLFSRPWLLQGH 542

  Fly   208 TRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHH-EWQHQCGQCGKYFSQFSYLNRHSLDAC 271
            .|:||||||:.|  ..|.|||:||||||:|.:|  |. :...:|.:|.|.|:..||||:|...||
  Fly   543 LRSHTGEKPYGC--AHCGKAFADRSNLRAHMQT--HSVDKNFECKRCHKTFALKSYLNKHLESAC 603

  Fly   272 RK 273
            .|
  Fly   604 LK 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 37/83 (45%)
C2H2 Zn finger 191..211 CDD:275368 8/19 (42%)
zf-H2C2_2 203..229 CDD:290200 13/25 (52%)
C2H2 Zn finger 219..244 CDD:275368 13/24 (54%)
C2H2 Zn finger 250..266 CDD:275368 8/15 (53%)
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 2/2 (100%)
C2H2 Zn finger 469..489 CDD:275370 2/2 (100%)
C2H2 Zn finger 500..520 CDD:275368 3/20 (15%)
COG5048 520..>617 CDD:227381 41/97 (42%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 539..562 CDD:290200 13/24 (54%)
C2H2 Zn finger 554..574 CDD:275368 13/23 (57%)
zf-C2H2 554..574 CDD:278523 13/23 (57%)
zf-H2C2_2 566..590 CDD:290200 9/25 (36%)
C2H2 Zn finger 582..599 CDD:275368 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.