DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and Kah

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster


Alignment Length:205 Identity:67/205 - (32%)
Similarity:87/205 - (42%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RREMEERLGIQLMSVLPITESSLLSHTIWELKMPGESFDSIPKT----------RNGIKVGIITV 138
            |:..|:.||:|       ..||:..|       .||..:.:..|          ..|.|....:.
  Fly    83 RQSSEDHLGLQ-------GHSSVHHH-------HGEQGEILNSTSLLEDEHICPECGKKYSTSSN 133

  Fly   139 TAESKQTR----TKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQ-FECIDCDKKF 198
            .|..:||.    .|..|..|....|.|             .||......|...| .||..|.|:|
  Fly   134 LARHRQTHRSIMDKKARHCPYCEKVYV-------------SMPAYSMHVRTHNQGCECQFCGKRF 185

  Fly   199 DHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHEWQHQCGQCGKYFSQFSYL 263
            ...|:|..|.|||||||||.|  |.|.|||:|:||||:|.:|..:.: .|.|.:|||.|:..|||
  Fly   186 SRPWLLQGHIRTHTGEKPFKC--GVCEKAFADKSNLRAHIQTHSNTK-PHTCARCGKAFALKSYL 247

  Fly   264 NRHSLDACRK 273
            .:|...:|.|
  Fly   248 YKHEESSCMK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 41/83 (49%)
C2H2 Zn finger 191..211 CDD:275368 8/19 (42%)
zf-H2C2_2 203..229 CDD:290200 16/25 (64%)
C2H2 Zn finger 219..244 CDD:275368 13/24 (54%)
C2H2 Zn finger 250..266 CDD:275368 8/15 (53%)
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 4/21 (19%)
C2H2 Zn finger 121..141 CDD:275368 4/19 (21%)
zf-C2H2 176..198 CDD:278523 9/21 (43%)
C2H2 Zn finger 178..198 CDD:275368 8/19 (42%)
zf-H2C2_2 191..214 CDD:290200 16/24 (67%)
zf-C2H2 204..226 CDD:278523 13/23 (57%)
C2H2 Zn finger 206..226 CDD:275368 12/21 (57%)
zf-H2C2_2 218..242 CDD:290200 10/24 (42%)
C2H2 Zn finger 234..250 CDD:275368 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.