DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and MESR4

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:242 Identity:46/242 - (19%)
Similarity:71/242 - (29%) Gaps:85/242 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QERFYDRYEDFCQVIP-----------------NLPPMPRP-KTNHHSRVATKPEPKTNVKFTYC 63
            |..||...|..|.:.|                 ::.|:|.. :...|.|   |.....::....|
  Fly  1164 QTNFYSYSEILCHICPGEVAGSVYDLQFRCCLCDMAPLPSAFRLMVHLR---KQHQACDICLEDC 1225

  Fly    64 FGQSEPSGD-WRQGDDIPIVVRREMEERLGIQLMSVLPITESSLLSHTIWELKMPGESFDSIPKT 127
            ..||:.|.. |:.       ....:..|.||...:     :..:..|..|               
  Fly  1226 QSQSKLSSHVWKH-------KLLHLCYRCGIAYRN-----KQDISKHLFW--------------- 1263

  Fly   128 RNGIKVGIITVTAESKQTRTKLKRKGPILANVTVPSNIVE--IPPIQQRKMPEKRRLKRVGGQFE 190
            ::|      |.:|..||...|..|            ::..  :||                .:|.
  Fly  1264 KHG------TESAGCKQCLQKRWR------------HVYHFCVPP----------------AEFP 1294

  Fly   191 CIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSH 237
            |..|...|..:..|..|.|.|||:..:.|.:..|.:.|..|..|..|
  Fly  1295 CEQCGFVFSKAIYLEVHQRMHTGDFRYACTEEGCEEKFVSRKLLLKH 1341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 16/50 (32%)
C2H2 Zn finger 191..211 CDD:275368 6/19 (32%)
zf-H2C2_2 203..229 CDD:290200 8/25 (32%)
C2H2 Zn finger 219..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 250..266 CDD:275368
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368 4/27 (15%)
C2H2 Zn finger 1295..1315 CDD:275370 6/19 (32%)
C2H2 Zn finger 1323..1341 CDD:275370 5/17 (29%)
PHD_ING 2110..2156 CDD:276980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.