DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and Scrt1

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001124042.1 Gene:Scrt1 / 366951 RGDID:1306236 Length:348 Species:Rattus norvegicus


Alignment Length:136 Identity:54/136 - (39%)
Similarity:70/136 - (51%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 KQTR----TKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQFECIDCDKKFDHSWM 203
            |||.    ::|.|:.|....|     .|.:|.:....:....|.|       |..|.|.|...|:
  Rat   210 KQTHRSLDSQLARRCPTCGKV-----YVSMPAMAMHLLTHDLRHK-------CGVCGKAFSRPWL 262

  Fly   204 LTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHEWQH-QCGQCGKYFSQFSYLNRHS 267
            |..|.|:|||||||.|  ..|.|||:||||||:|.:|  |..::| ||.:|.|.|:..||||:|.
  Rat   263 LQGHMRSHTGEKPFGC--AHCGKAFADRSNLRAHMQT--HSAFKHFQCKRCKKSFALKSYLNKHY 323

  Fly   268 LDACRK 273
            ..||.|
  Rat   324 ESACFK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 40/83 (48%)
C2H2 Zn finger 191..211 CDD:275368 8/19 (42%)
zf-H2C2_2 203..229 CDD:290200 14/25 (56%)
C2H2 Zn finger 219..244 CDD:275368 13/24 (54%)
C2H2 Zn finger 250..266 CDD:275368 8/15 (53%)
Scrt1NP_001124042.1 C2H2 Zn finger 193..213 CDD:275368 2/2 (100%)
C2H2 Zn finger 224..241 CDD:275371 4/21 (19%)
COG5048 <245..>313 CDD:227381 36/78 (46%)
C2H2 Zn finger 250..270 CDD:275368 8/19 (42%)
C2H2 Zn finger 278..298 CDD:275368 13/23 (57%)
C2H2 Zn finger 306..322 CDD:275368 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.