DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7691 and CG1602

DIOPT Version :9

Sequence 1:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	NP_610291.2	Gene:	CG1602 / 35684	FlyBaseID:	FBgn0033186	Length:	577	Species:	Drosophila melanogaster

Alignment Length:	129	Identity:	37/129 - (28%)
Similarity:	52/129 - (40%)	Gaps:	32/129 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   185 VGGQFECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRS-----------NLRSHQ 238
            :|...:|..|::.|.....|..|.|||||.||:||.  .|.|||..||           .:|:.:
  Fly   419 IGKTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCE--HCGKAFRLRSQMTLHVTAIHTKIRAFK 481

  Fly   239 RTM----------------GHHEWQHQ-CGQCGKYFSQFSYLNRHSL--DACRKYLLSVMHKRF 283
            .||                ||...:.: |..|||.|:....|.||..  ...:|::..:...||
  Fly   482 CTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRHRQIHSEVKKFVCKLCDSRF 545

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	33/112 (29%)
		C2H2 Zn finger	191..211	CDD:275368	6/19 (32%)
		zf-H2C2_2	203..229	CDD:290200	14/25 (56%)
		C2H2 Zn finger	219..244	CDD:275368	11/51 (22%)
		C2H2 Zn finger	250..266	CDD:275368	6/15 (40%)
CG1602	NP_610291.2	GT1	157..244	CDD:304916
		MADF_DNA_bdg	273..356	CDD:287510
		C2H2 Zn finger	367..388	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368
		COG5048	<423..554	CDD:227381	36/125 (29%)
		C2H2 Zn finger	425..445	CDD:275368	6/19 (32%)
		zf-H2C2_2	437..460	CDD:290200	13/24 (54%)
		C2H2 Zn finger	453..470	CDD:275368	7/18 (39%)
		C2H2 Zn finger	482..502	CDD:275368	2/19 (11%)
		C2H2 Zn finger	510..530	CDD:275368	8/19 (42%)
		C2H2 Zn finger	538..559	CDD:275368	2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24393
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	2.010