DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and CG10348

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster


Alignment Length:282 Identity:68/282 - (24%)
Similarity:102/282 - (36%) Gaps:88/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PNLPPMPRPKTNHHSRVATKPEPKTNVKFTYCFGQSEPSGDWRQGDDIPIV---VRREMEERLGI 93
            ||.||:..|:.:                                   ||.|   :...|.:.|.:
  Fly   182 PNAPPLTPPQCS-----------------------------------IPAVHPTLLEAMTKNLPL 211

  Fly    94 QLMSVL----------PITESSLLSHTIWELKMPGESFDSIPKTRNGIKVGIITVTAESKQTRTK 148
            |..:|.          |...||          ..|..|    ..|:.:|...:|....::|.:.:
  Fly   212 QYRNVFAGVLPGKVNSPAASSS----------PTGADF----PFRHPLKKCELTWPPPTEQLQLE 262

  Fly   149 LKRKGPILANVTVPSNIVEIPPIQ--QRKMPEKRRLKRVGG------------QFECIDCDKKFD 199
            |....|.|      |.::..|.:|  |.:...|.|....||            ::.|..|.|.|.
  Fly   263 LPHPNPKL------SPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFP 321

  Fly   200 HSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHEWQHQCGQCGKYFSQFS--- 261
            .|..||.|.||||||:|:.|.  .|.::||..|||:.|.|.:.:.|...:|..|.:.|.|.:   
  Fly   322 RSANLTRHLRTHTGEQPYKCK--YCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLD 384

  Fly   262 -YLNRHSLDACRKYLLSVMHKR 282
             :|.:|..||.....||.:.:|
  Fly   385 RHLKKHESDAVSLSALSGVSER 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 32/86 (37%)
C2H2 Zn finger 191..211 CDD:275368 9/19 (47%)
zf-H2C2_2 203..229 CDD:290200 12/25 (48%)
C2H2 Zn finger 219..244 CDD:275368 9/24 (38%)
C2H2 Zn finger 250..266 CDD:275368 5/19 (26%)
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 24/64 (38%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/25 (48%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 7/23 (30%)
zf-C2H2 368..390 CDD:278523 5/21 (24%)
C2H2 Zn finger 370..390 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.