Sequence 1: | NP_650728.1 | Gene: | CG7691 / 42228 | FlyBaseID: | FBgn0038626 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609786.2 | Gene: | CG17328 / 34962 | FlyBaseID: | FBgn0028895 | Length: | 413 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 58/202 - (28%) |
---|---|---|---|
Similarity: | 78/202 - (38%) | Gaps: | 39/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 DDIPIVVRREMEERLGIQLMSVLPITESSLLSHTIWELKMPGESFDSIPKTRNGIKVGIITVTAE 141
Fly 142 SKQTRTKLKRKGPIL------ANVTVPSNIVEIPPIQQRKMPE---KRRLKRVGGQ-FECIDCDK 196
Fly 197 KFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHH--EWQHQCGQCGKYFSQ 259
Fly 260 FSYLNRH 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7691 | NP_650728.1 | COG5048 | 188..>271 | CDD:227381 | 31/82 (38%) |
C2H2 Zn finger | 191..211 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 203..229 | CDD:290200 | 13/25 (52%) | ||
C2H2 Zn finger | 219..244 | CDD:275368 | 8/24 (33%) | ||
C2H2 Zn finger | 250..266 | CDD:275368 | 5/15 (33%) | ||
CG17328 | NP_609786.2 | zf-AD | 8..80 | CDD:214871 | 10/53 (19%) |
COG5048 | 146..>211 | CDD:227381 | 27/69 (39%) | ||
C2H2 Zn finger | 149..169 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 8/24 (33%) | ||
zf-H2C2_2 | 189..213 | CDD:404364 | 10/26 (38%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 6/17 (35%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | |||
zf-H2C2_2 | 245..270 | CDD:404364 | |||
C2H2 Zn finger | 261..282 | CDD:275368 | |||
C2H2 Zn finger | 318..338 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24393 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |