DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and erm

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster


Alignment Length:159 Identity:48/159 - (30%)
Similarity:71/159 - (44%) Gaps:17/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SIPKTRNGI-KVGIITVTAESKQTRTKLKRK----------GPILANVTVPSNIVEIPPIQQRKM 176
            ::|..::.: |..:...||:|...:..||||          .|..:..|..:......|..|..:
  Fly   238 AVPNLQHTLEKSPVAQRTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSI 302

  Fly   177 PEKRRLKRVGGQ---FECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQ 238
            .:.......||:   |.|::|.|.|:..:.||.|...|||.:||||.  .|.|.|...|.|..| 
  Fly   303 EDSSPGSASGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCK--VCGKGFRQASTLCRH- 364

  Fly   239 RTMGHHEWQHQCGQCGKYFSQFSYLNRHS 267
            :.:...|..|:|..|||.|::.|.||.||
  Fly   365 KIIHTSEKPHKCQTCGKAFNRSSTLNTHS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 33/83 (40%)
C2H2 Zn finger 191..211 CDD:275368 7/19 (37%)
zf-H2C2_2 203..229 CDD:290200 12/25 (48%)
C2H2 Zn finger 219..244 CDD:275368 7/24 (29%)
C2H2 Zn finger 250..266 CDD:275368 8/15 (53%)
ermNP_001259891.2 COG5048 <295..461 CDD:227381 37/102 (36%)
C2H2 Zn finger 320..340 CDD:275368 7/19 (37%)
zf-H2C2_2 332..357 CDD:290200 13/26 (50%)
zf-C2H2 346..368 CDD:278523 9/24 (38%)
C2H2 Zn finger 348..368 CDD:275368 7/22 (32%)
zf-H2C2_2 363..385 CDD:290200 8/22 (36%)
C2H2 Zn finger 376..396 CDD:275368 10/18 (56%)
zf-H2C2_2 389..413 CDD:290200 4/5 (80%)
C2H2 Zn finger 404..424 CDD:275368
zf-H2C2_2 416..441 CDD:290200
C2H2 Zn finger 432..452 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.