DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7691 and Snai3

DIOPT Version :9

Sequence 1:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	XP_006531137.1	Gene:	Snai3 / 30927	MGIID:	1353563	Length:	327	Species:	Mus musculus

Alignment Length:	50	Identity:	27/50 - (54%)
Similarity:	33/50 - (66%)	Gaps:	2/50 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   191 CIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRT 240
            |..|.|.|...|:|..|.||||||||:.|  ..|.:||:||||||:|.:|
Mouse   206 CKVCGKAFSRPWLLQGHIRTHTGEKPYTC--SHCSRAFADRSNLRAHLQT 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	26/49 (53%)
		C2H2 Zn finger	191..211	CDD:275368	8/19 (42%)
		zf-H2C2_2	203..229	CDD:290200	13/25 (52%)
		C2H2 Zn finger	219..244	CDD:275368	11/21 (52%)
		C2H2 Zn finger	250..266	CDD:275368
Snai3	XP_006531137.1	C2H2 Zn finger	149..169	CDD:275368
		C2H2 Zn finger	180..200	CDD:275368
		C2H2 Zn finger	206..226	CDD:275368	8/19 (42%)
		zf-C2H2	206..226	CDD:333835	8/19 (42%)
		zf-H2C2_2	219..242	CDD:372612	13/24 (54%)
		zf-C2H2	232..254	CDD:333835	11/23 (48%)
		C2H2 Zn finger	234..254	CDD:275368	11/21 (52%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900