DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and prz1

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_593073.1 Gene:prz1 / 2541806 PomBaseID:SPAC4G8.13c Length:681 Species:Schizosaccharomyces pombe


Alignment Length:266 Identity:55/266 - (20%)
Similarity:98/266 - (36%) Gaps:62/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VIPNLPPMPRPKTNHHSRVATKPEPKTNVKFTYCFGQSEPSGDWRQGDD--------------IP 80
            |:|:.|    .|:.....:...|..:|::..||....|..||.....::              .|
pombe   414 VVPSSP----SKSQSGPSLPANPLLQTDISITYSQSASPVSGQPAMNENSYDLQNANLCAPEMSP 474

  Fly    81 IVVRREMEERLGIQLMSVLPI-------TESSLLSHTIWELKMPGESFDSIPKTRNGIKVGIITV 138
            ....|......|.:..:..||       :.||.......:.::.|:..:...|:.:.:.|     
pombe   475 TYTARHRSNSAGSRFDAYEPIPQLYTHFSHSSECLSVNQDTELLGKIENDNSKSNDYLSV----- 534

  Fly   139 TAESKQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQFEC--IDCDKKFDHS 201
                :.||.:.:....::.|.:..|:      ..:.|...|.:     |.:.|  ..|:|:|..:
pombe   535 ----RNTRPRSRSLNSLVGNKSENSS------SSKAKSESKSQ-----GNYVCTFAGCNKRFTRA 584

  Fly   202 WMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHEWQH------QCGQCGKYFSQF 260
            :.|.:|..|||..:||.|  ..|:|:|:     |.|.:.  .||..|      .|..|.:.|::.
pombe   585 YNLKSHMNTHTNYRPFQC--SICKKSFA-----RQHDKR--RHEQLHTGIKAFACVTCNQRFARM 640

  Fly   261 SYLNRH 266
            ..||||
pombe   641 DALNRH 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 27/87 (31%)
C2H2 Zn finger 191..211 CDD:275368 6/21 (29%)
zf-H2C2_2 203..229 CDD:290200 10/25 (40%)
C2H2 Zn finger 219..244 CDD:275368 6/24 (25%)
C2H2 Zn finger 250..266 CDD:275368 5/15 (33%)
prz1NP_593073.1 COG5048 121..620 CDD:227381 46/238 (19%)
zf-C2H2 570..594 CDD:278523 6/23 (26%)
C2H2 Zn finger 577..594 CDD:275368 5/16 (31%)
zf-H2C2_2 586..611 CDD:290200 11/31 (35%)
C2H2 Zn finger 602..622 CDD:275368 8/28 (29%)
zf-H2C2_2 616..639 CDD:290200 6/24 (25%)
C2H2 Zn finger 630..648 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.