DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and scrt-1

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_491001.2 Gene:scrt-1 / 183848 WormBaseID:WBGene00016948 Length:178 Species:Caenorhabditis elegans


Alignment Length:196 Identity:57/196 - (29%)
Similarity:89/196 - (45%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IPIVVRREMEERLGIQLMSV-LPITESSLLSHTIWELKMPGESFDSIPKTRNGIKVGIITVTAES 142
            ||.:: .|::::...|:..: :|...:|..|.::....:..:|....|.|         |||:.|
 Worm    21 IPSLI-EEVQKKYNSQVRLIPIPYLPASSSSPSLPSFSLHSDSPSLSPST---------TVTSYS 75

  Fly   143 KQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLK--RVGGQFECIDCDKKFDHSWMLT 205
                              .||:            |:.::||  ......:|..|.|:|...|:|.
 Worm    76 ------------------TPSS------------PDGKQLKFATCSPVCQCKVCGKRFSRQWLLQ 110

  Fly   206 AHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHEWQHQCGQCGKYFSQFSYLNRHSLDA 270
            .|.|||||||||.|.  .|.|.|:|:||||:|.:|....: .|:|.:|||.|:..|||::|....
 Worm   111 GHLRTHTGEKPFQCE--ICSKRFADKSNLRAHIQTHSGTK-PHKCPRCGKSFALKSYLSKHEESK 172

  Fly   271 C 271
            |
 Worm   173 C 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 37/82 (45%)
C2H2 Zn finger 191..211 CDD:275368 8/19 (42%)
zf-H2C2_2 203..229 CDD:290200 14/25 (56%)
C2H2 Zn finger 219..244 CDD:275368 11/24 (46%)
C2H2 Zn finger 250..266 CDD:275368 8/15 (53%)
scrt-1NP_491001.2 zf-C2H2 94..116 CDD:278523 8/21 (38%)
C2H2 Zn finger 96..116 CDD:275368 8/19 (42%)
zf-H2C2_2 109..132 CDD:290200 14/24 (58%)
C2H2 Zn finger 124..144 CDD:275368 10/21 (48%)
zf-H2C2_2 136..160 CDD:290200 10/24 (42%)
C2H2 Zn finger 152..168 CDD:275368 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11802
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.