Sequence 1: | NP_650728.1 | Gene: | CG7691 / 42228 | FlyBaseID: | FBgn0038626 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491001.2 | Gene: | scrt-1 / 183848 | WormBaseID: | WBGene00016948 | Length: | 178 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 57/196 - (29%) |
---|---|---|---|
Similarity: | 89/196 - (45%) | Gaps: | 46/196 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 IPIVVRREMEERLGIQLMSV-LPITESSLLSHTIWELKMPGESFDSIPKTRNGIKVGIITVTAES 142
Fly 143 KQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLK--RVGGQFECIDCDKKFDHSWMLT 205
Fly 206 AHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHEWQHQCGQCGKYFSQFSYLNRHSLDA 270
Fly 271 C 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7691 | NP_650728.1 | COG5048 | 188..>271 | CDD:227381 | 37/82 (45%) |
C2H2 Zn finger | 191..211 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 203..229 | CDD:290200 | 14/25 (56%) | ||
C2H2 Zn finger | 219..244 | CDD:275368 | 11/24 (46%) | ||
C2H2 Zn finger | 250..266 | CDD:275368 | 8/15 (53%) | ||
scrt-1 | NP_491001.2 | zf-C2H2 | 94..116 | CDD:278523 | 8/21 (38%) |
C2H2 Zn finger | 96..116 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 109..132 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 124..144 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 136..160 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 152..168 | CDD:275368 | 8/15 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X11802 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |