DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and che-1

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001076598.1 Gene:che-1 / 183847 WormBaseID:WBGene00000483 Length:273 Species:Caenorhabditis elegans


Alignment Length:133 Identity:46/133 - (34%)
Similarity:66/133 - (49%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PSNIVEIPPIQQRKMPEKRRL-------KRVGGQFECIDCDKKFDHSWMLTAHTRTHTGEKPFVC 219
            ||.:..:.|....::|:|..|       :.....|.|..|.|.|..:..||||.|.|||||||:|
 Worm   132 PSGLCYMDPTPSLRLPKKEPLPVQRPMARSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMC 196

  Fly   220 PDGSCRKAFSDRSNLRSHQRTMGHH--EWQHQCGQCGKYFSQFSYLNRH--SLDACRKYLLSVMH 280
            |  .|.:.||..|:|.:|:||   |  |..:.|.||.|.|:..|.|.:|  :....:.|:.|:..
 Worm   197 P--VCNRPFSQSSSLVTHRRT---HTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICM 256

  Fly   281 KRF 283
            .:|
 Worm   257 MKF 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 37/86 (43%)
C2H2 Zn finger 191..211 CDD:275368 9/19 (47%)
zf-H2C2_2 203..229 CDD:290200 15/25 (60%)
C2H2 Zn finger 219..244 CDD:275368 10/24 (42%)
C2H2 Zn finger 250..266 CDD:275368 7/15 (47%)
che-1NP_001076598.1 zf-C2H2 166..188 CDD:278523 10/21 (48%)
C2H2 Zn finger 168..188 CDD:275368 9/19 (47%)
zf-H2C2_2 180..205 CDD:290200 16/26 (62%)
C2H2 Zn finger 196..216 CDD:275368 10/24 (42%)
zf-H2C2_2 208..232 CDD:290200 10/26 (38%)
C2H2 Zn finger 224..244 CDD:275368 8/19 (42%)
zf-H2C2_2 237..261 CDD:290200 5/23 (22%)
C2H2 Zn finger 252..272 CDD:275368 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.