DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7691 and LOC101884037

DIOPT Version :9

Sequence 1:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster
Sequence 2:	XP_017207359.1	Gene:	LOC101884037 / 101884037	-ID:	-	Length:	308	Species:	Danio rerio

Alignment Length:	132	Identity:	42/132 - (31%)
Similarity:	59/132 - (44%)	Gaps:	29/132 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   164 NIVEIPPIQQRKMPEKRRLKRVGGQFECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAF 228
            |:.:...|..|:.|           ::|..|:|.|.....|..|.:.||||||.:|  ..|.|.|
Zfish   181 NLKKHEMIHTREKP-----------YKCSHCEKSFSQPGHLKTHEKIHTGEKPHIC--SHCNKRF 232

  Fly   229 SDRSNLRSHQRTMGHH--EWQHQCGQCGKYFSQFSYLNRH----------SLDACRK-YLLSVMH 280
            ....||::|:|.   |  |..::|..|.|.|||..||..|          |.|.|:| ::.||..
Zfish   233 ICSENLKTHERI---HTGEKPYKCSHCDKSFSQSGYLKTHERIHTGEKLYSCDQCQKSFIQSVQL 294

  Fly   281 KR 282
            |:
Zfish   295 KK 296

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	33/94 (35%)
		C2H2 Zn finger	191..211	CDD:275368	6/19 (32%)
		zf-H2C2_2	203..229	CDD:290200	11/25 (44%)
		C2H2 Zn finger	219..244	CDD:275368	8/24 (33%)
		C2H2 Zn finger	250..266	CDD:275368	8/15 (53%)
LOC101884037	XP_017207359.1	COG5048	<51..263	CDD:227381	31/97 (32%)
		C2H2 Zn finger	57..77	CDD:275368
		C2H2 Zn finger	85..105	CDD:275368
		C2H2 Zn finger	113..133	CDD:275368
		zf-H2C2_2	125..150	CDD:290200
		C2H2 Zn finger	141..161	CDD:275368
		zf-H2C2_2	153..178	CDD:290200
		C2H2 Zn finger	169..189	CDD:275368	1/7 (14%)
		zf-H2C2_2	181..206	CDD:290200	8/35 (23%)
		C2H2 Zn finger	197..217	CDD:275368	6/19 (32%)
		C2H2 Zn finger	225..245	CDD:275368	8/24 (33%)
		zf-H2C2_2	237..262	CDD:290200	10/27 (37%)
		C2H2 Zn finger	253..273	CDD:275368	9/19 (47%)
		C2H2 Zn finger	281..301	CDD:275368	6/16 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.100