DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7691 and mazb

DIOPT Version :9

Sequence 1:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_001918976.1 Gene:mazb / 100150156 ZFINID:ZDB-GENE-110603-5 Length:464 Species:Danio rerio


Alignment Length:263 Identity:60/263 - (22%)
Similarity:98/263 - (37%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PNLPP----MPRPKTNHHSRVATKPEPKTNVK--------FTYCFGQSEPSGDWRQGDDIPIVVR 84
            |..||    .|.|.|...:.:...|.|...|.        .:.|..|.:.|.:.|:...:...:|
Zfish    35 PQAPPTDHMAPPPSTVDTAALNEDPVPVKPVSRPARAAHICSICSKQFKNSYNLRRHQSVHTGIR 99

  Fly    85 ------------REMEERLGIQLMSVLPITESS--LLSHTIWELKMPGESFDSI-PKTRNGIKVG 134
                        ::..|:..: |:|:|.:.:.|  |...|:    ||.:....: |...|.:.:.
Zfish   100 MKTGAQNQEAQAKDSSEKHTV-LLSLLHLQQQSQTLPPPTV----MPAQHTQILAPPDGNDVAME 159

  Fly   135 IITVTAESKQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQFECIDCDKKFD 199
            .:..|.      |.|....|::.....|..    .|:.|...|.::       ...|..|.|.|.
Zfish   160 SVASTV------TALPPPPPVVMATGEPVQ----RPVNQNPNPVRK-------NHACETCGKAFR 207

  Fly   200 HSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRT-MGHHEWQHQCGQCGKYFSQFSYL 263
            ..:.|..|..:|:.||||.||  .|::.|..:..:..|.|: .|..|..:.|..|.|.||:..:|
Zfish   208 DVYHLNRHRLSHSDEKPFSCP--ICQQRFKRKDRMSHHVRSHQGGVEKPYVCPHCAKAFSRPDHL 270

  Fly   264 NRH 266
            |.|
Zfish   271 NSH 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 27/80 (34%)
C2H2 Zn finger 191..211 CDD:275368 6/19 (32%)
zf-H2C2_2 203..229 CDD:290200 10/25 (40%)
C2H2 Zn finger 219..244 CDD:275368 7/25 (28%)
C2H2 Zn finger 250..266 CDD:275368 7/15 (47%)
mazbXP_001918976.1 C2H2 Zn finger 75..95 CDD:275368 4/19 (21%)
C2H2 Zn finger 199..219 CDD:275368 6/19 (32%)
zf-H2C2_2 211..236 CDD:290200 11/26 (42%)
C2H2 Zn finger 227..247 CDD:275368 6/21 (29%)
C2H2 Zn finger 257..275 CDD:275368 8/17 (47%)
C2H2 Zn finger 286..306 CDD:275368
C2H2 Zn finger 312..331 CDD:275368
C2H2 Zn finger 339..360 CDD:275368
C2H2 Zn finger 382..402 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.