Sequence 1: | NP_650728.1 | Gene: | CG7691 / 42228 | FlyBaseID: | FBgn0038626 | Length: | 283 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001918976.1 | Gene: | mazb / 100150156 | ZFINID: | ZDB-GENE-110603-5 | Length: | 464 | Species: | Danio rerio |
Alignment Length: | 263 | Identity: | 60/263 - (22%) |
---|---|---|---|
Similarity: | 98/263 - (37%) | Gaps: | 52/263 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 PNLPP----MPRPKTNHHSRVATKPEPKTNVK--------FTYCFGQSEPSGDWRQGDDIPIVVR 84
Fly 85 ------------REMEERLGIQLMSVLPITESS--LLSHTIWELKMPGESFDSI-PKTRNGIKVG 134
Fly 135 IITVTAESKQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQFECIDCDKKFD 199
Fly 200 HSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRT-MGHHEWQHQCGQCGKYFSQFSYL 263
Fly 264 NRH 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7691 | NP_650728.1 | COG5048 | 188..>271 | CDD:227381 | 27/80 (34%) |
C2H2 Zn finger | 191..211 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 203..229 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 219..244 | CDD:275368 | 7/25 (28%) | ||
C2H2 Zn finger | 250..266 | CDD:275368 | 7/15 (47%) | ||
mazb | XP_001918976.1 | C2H2 Zn finger | 75..95 | CDD:275368 | 4/19 (21%) |
C2H2 Zn finger | 199..219 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 211..236 | CDD:290200 | 11/26 (42%) | ||
C2H2 Zn finger | 227..247 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 257..275 | CDD:275368 | 8/17 (47%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | |||
C2H2 Zn finger | 312..331 | CDD:275368 | |||
C2H2 Zn finger | 339..360 | CDD:275368 | |||
C2H2 Zn finger | 382..402 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24393 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |