| Sequence 1: | NP_650728.1 | Gene: | CG7691 / 42228 | FlyBaseID: | FBgn0038626 | Length: | 283 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001076468.1 | Gene: | zbtb49 / 100009630 | ZFINID: | ZDB-GENE-070209-170 | Length: | 524 | Species: | Danio rerio |
| Alignment Length: | 310 | Identity: | 75/310 - (24%) |
|---|---|---|---|
| Similarity: | 96/310 - (30%) | Gaps: | 116/310 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 KQERFYDRYEDFCQVIPNLPPMPR-PKTNHHSRVATKPEPKTNVKFTYCFGQSEPSGDWRQGDDI 79
Fly 80 PIVVRREMEERLGIQLMSVLPITESSLLSHTIWELKMPGESFDSIPKTRNGIKVGIITVTAESKQ 144
Fly 145 TRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPE-----------KRRLKRVGG---QFECIDCD 195
Fly 196 KKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSH-QRTMGHHEW------------- 246
Fly 247 -------------QHQCGQCGKYFSQFSYLNRH----------SLDACRK 273 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7691 | NP_650728.1 | COG5048 | 188..>271 | CDD:227381 | 37/119 (31%) |
| C2H2 Zn finger | 191..211 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 203..229 | CDD:290200 | 14/25 (56%) | ||
| C2H2 Zn finger | 219..244 | CDD:275368 | 11/25 (44%) | ||
| C2H2 Zn finger | 250..266 | CDD:275368 | 8/15 (53%) | ||
| zbtb49 | NP_001076468.1 | zf-H2C2_2 | 322..346 | CDD:290200 | 5/23 (22%) |
| C2H2 Zn finger | 338..358 | CDD:275368 | 0/19 (0%) | ||
| C2H2 Zn finger | 366..386 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 378..402 | CDD:290200 | 5/22 (23%) | ||
| C2H2 Zn finger | 394..414 | CDD:275368 | 3/6 (50%) | ||
| zf-H2C2_2 | 407..430 | CDD:290200 | |||
| C2H2 Zn finger | 422..442 | CDD:275368 | |||
| zf-H2C2_2 | 434..459 | CDD:290200 | |||
| C2H2 Zn finger | 450..467 | CDD:275368 | |||
| BTB | 15..118 | CDD:279045 | |||
| BTB | 26..118 | CDD:197585 | |||
| zf-C2H2 | 280..302 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 8/19 (42%) | ||
| COG5048 | <292..466 | CDD:227381 | 34/110 (31%) | ||
| zf-H2C2_2 | 294..319 | CDD:290200 | 15/26 (58%) | ||
| C2H2 Zn finger | 310..330 | CDD:275368 | 9/21 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24393 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||