DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fru and lolal

DIOPT Version :9

Sequence 1:NP_001163648.1 Gene:fru / 42226 FlyBaseID:FBgn0004652 Length:960 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:114 Identity:61/114 - (53%)
Similarity:81/114 - (71%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 DQQFCLRWNNHPTNLTGVLTSLLQREALCDVTLACEGETVKAHQTILSACSPYFETIFLQNQHPH 172
            ||||.|:||:..||:......|...::..||||||||:|.|||:.:||||||||:.:..:|...|
  Fly     5 DQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKH 69

  Fly   173 PIIYLKDVRYSEMRSLLDFMYKGEVNVGQSSLPMFLKTAESLQVRGLTD 221
            |||.||||.|..::::|:|||.|||||.|..||.|||||:.|:|:||.:
  Fly    70 PIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fruNP_001163648.1 BTB 126..221 CDD:279045 52/94 (55%)
BTB 137..221 CDD:197585 51/83 (61%)
C2H2 Zn finger 901..918 CDD:275368
C2H2 Zn finger 925..944 CDD:275368
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 49/82 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451886
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.