DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fru and ztf-25

DIOPT Version :9

Sequence 1:NP_001163648.1 Gene:fru / 42226 FlyBaseID:FBgn0004652 Length:960 Species:Drosophila melanogaster
Sequence 2:NP_507456.1 Gene:ztf-25 / 180158 WormBaseID:WBGene00012405 Length:244 Species:Caenorhabditis elegans


Alignment Length:188 Identity:39/188 - (20%)
Similarity:66/188 - (35%) Gaps:44/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   718 EYKCKELNMRAIRCSRQQHMMSHYSPHHPHHRSLIDCPAEAAYSPPVANNQAYLASNGAVQQLDL 782
            |.|..:|..:.|..|..||...:.|.:  .||.|:.           .|....:..:..:...:.
 Worm    15 ELKRPDLRGKFICASCGQHFQHNASLN--RHRRLLH-----------GNEHTCMMCDRKLNAKET 66

  Fly   783 STYHGHANHQLHQHPPSA----THPSHSQSSPHYPSASGAGAGAGSVSVSIAGSASGSATSAPAS 843
            ...|....|.|.|.....    :..|..|.|.|.....|.||...::.::       .:.:||.|
 Worm    67 IRDHMRNEHNLFQVFTCGCCNWSFSSKRQLSEHTKCIQGTGAPGDTIPIA-------KSCNAPGS 124

  Fly   844 VATSAVSPQPSSSST-----GSTSSAAAVAAAAAAAANRRDHNIDYSTLFVQLSGTLP 896
            :..|.:...|....|     ||.||:::|:.:.::    ||           :||:.|
 Worm   125 LIQSTIQGTPPVVKTGRKRGGSLSSSSSVSTSISS----RD-----------VSGSPP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fruNP_001163648.1 BTB 126..221 CDD:279045
BTB 137..221 CDD:197585
C2H2 Zn finger 901..918 CDD:275368
C2H2 Zn finger 925..944 CDD:275368
ztf-25NP_507456.1 COG5236 <22..>122 CDD:227561 20/119 (17%)
C2H2 Zn finger 27..48 CDD:275368 7/22 (32%)
C2H2 Zn finger 54..75 CDD:275368 1/20 (5%)
C2H2 Zn finger 83..102 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7558
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.