DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10864 and KCNK6

DIOPT Version :10

Sequence 1:NP_650726.1 Gene:CG10864 / 42222 FlyBaseID:FBgn0038621 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_004814.1 Gene:KCNK6 / 9424 HGNCID:6281 Length:313 Species:Homo sapiens


Alignment Length:122 Identity:30/122 - (24%)
Similarity:46/122 - (37%) Gaps:36/122 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 ISLCPTDVDLRIVTLDELIEKEFRIIVVGPS--------DQDMDGCCFRSAALQNKW-PRKNNTS 230
            :.:..|.||...|..|        :||.||.        |:..|      ...|..| |..:|.|
Human   575 VCMVQTSVDKLSVAAD--------LIVRGPPGPPEAVTIDEITD------TTAQLSWRPGPDNHS 625

  Fly   231 DLLVYLQAQIHAPVTPGLRVLQGVITPELSDIFRNLRSSLKKTFSLPMRGLLKEWLQ 287
            .:.:|: .|...|.:.|.:.:..|  |:|.|         .|||:..:.| |..|::
Human   626 PITMYV-IQARTPFSVGWQAVNTV--PDLVD---------GKTFTATVVG-LNPWVE 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10864NP_650726.1 Ion_trans_2 <141..197 CDD:462301 5/21 (24%)
Ion_trans_2 242..>284 CDD:462301 11/41 (27%)
KCNK6NP_004814.1 Ion_trans_2 75..146 CDD:462301
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 106..111
Ion_trans_2 180..256 CDD:462301
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 214..219
Lysosomal targeting signal. /evidence=ECO:0000250|UniProtKB:G3V8R8 282..290
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..313
Lysosomal targeting signal. /evidence=ECO:0000250|UniProtKB:G3V8R8 308..312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.