DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10864 and C27F2.6

DIOPT Version :10

Sequence 1:NP_650726.1 Gene:CG10864 / 42222 FlyBaseID:FBgn0038621 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_498055.1 Gene:C27F2.6 / 182966 WormBaseID:WBGene00016168 Length:165 Species:Caenorhabditis elegans


Alignment Length:57 Identity:18/57 - (31%)
Similarity:30/57 - (52%) Gaps:2/57 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 MTRKKVIVPSTACLWVIFFYVLTGTVMFANWEKWSLLNSFYFCMTSLCKIGFGDFVP 284
            :.|..:|..|:..|..|  .:|:.:.:|::.|..|..:|.||...::..|.|||.||
 Worm    15 LQRDNLIFLSSLLLCSI--SLLSSSALFSSIENISYQSSAYFGFMTIFGISFGDIVP 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10864NP_650726.1 Ion_trans_2 <141..197 CDD:462301
Ion_trans_2 242..>284 CDD:462301 12/41 (29%)
C27F2.6NP_498055.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.