DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10864 and kcnk18

DIOPT Version :10

Sequence 1:NP_650726.1 Gene:CG10864 / 42222 FlyBaseID:FBgn0038621 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_031761959.1 Gene:kcnk18 / 100486306 XenbaseID:XB-GENE-6257492 Length:429 Species:Xenopus tropicalis


Alignment Length:113 Identity:26/113 - (23%)
Similarity:46/113 - (40%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 KTFSLPMRGLLKEWLQRLDDEEIGNLNILISDQVDTEFCRLVYYLNINEYPEHKLDSYSVNPYLE 336
            :|.|...:.||...|::...:.:|...   ||..:....|....:|..:..:.||    :.|:..
 Frog   309 RTLSPEAKSLLAGLLKKDPKQRLGGGP---SDAKEVMEHRFFLSINWQDVVQKKL----LPPFKP 366

  Fly   337 NKPRALKTKNWDAEITYP----TPPESDKKERSVLNEPLEDGENEPEF 380
            .....:.|:.:|.|.|..    |||  |:.:...|.| |:...:.|:|
 Frog   367 QVTSEVDTRYFDDEFTAQSITITPP--DRYDSLGLLE-LDQRTHFPQF 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10864NP_650726.1 Ion_trans_2 <141..197 CDD:462301
Ion_trans_2 242..>284 CDD:462301 4/11 (36%)
kcnk18XP_031761959.1 Ion_trans_2 <134..>175 CDD:462301
Ion_trans_2 322..402 CDD:462301 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.