DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7685 and GTB1

DIOPT Version :10

Sequence 1:NP_650724.1 Gene:CG7685 / 42220 FlyBaseID:FBgn0038619 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_010507.3 Gene:GTB1 / 851807 SGDID:S000002629 Length:702 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:38/104 - (36%)
Similarity:53/104 - (50%) Gaps:27/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 YDAYKPNFEGKFRCLDGSKEIPFD--HLNDNYCDCEEDGSDEPSTNAC--------AKG------ 163
            ||:.:|:.. |:.||: .::|..|  .:||..||| .||||||.:.||        |:|      
Yeast    39 YDSNEPDLT-KWHCLN-HEDIVLDISQINDGVCDC-PDGSDEPGSAACVEDIFKSVAEGGGKVNK 100

  Fly   164 RFYCRYQKRHITGRG-LDIYVASSRINDHVCDCCDGSDE 201
            .|||       ..:| :..|:..|.:.|.:|||||.|||
Yeast   101 YFYC-------DNKGFIPRYIRKSEVADGICDCCDCSDE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7685NP_650724.1 PRKCSH-like 97..>213 CDD:372423 38/104 (37%)
GTB1NP_010507.3 PRKCSH-like 28..187 CDD:372423 38/104 (37%)
CwlO1 168..>315 CDD:443091
PRKCSH <635..695 CDD:414904
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.