DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7685 and Prkcsh

DIOPT Version :10

Sequence 1:NP_650724.1 Gene:CG7685 / 42220 FlyBaseID:FBgn0038619 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001280579.1 Gene:Prkcsh / 19089 MGIID:107877 Length:528 Species:Mus musculus


Alignment Length:111 Identity:55/111 - (49%)
Similarity:71/111 - (63%) Gaps:13/111 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 IKIVRGTRLFDYDAYKPNFEGK-FRCLDGSKEIPFDHLNDNYCDCEEDGSDEPSTNACAKGRFYC 167
            :|..||..|.::..|:   |.| |.||||:..||||.:||:|||| :||||||.|.||..|.|:|
Mouse    17 VKRPRGVSLSNHHFYE---ESKPFTCLDGTATIPFDQVNDDYCDC-KDGSDEPGTAACPNGSFHC 77

  Fly   168 RYQKRHITGRGL-DIYVASSRINDHVCDCCDGSDEWSTATKCPNDC 212
                   |..|. .:|:.|||:||.|||||||:||:::.|.|.|.|
Mouse    78 -------TNTGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTC 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7685NP_650724.1 PRKCSH-like 97..>213 CDD:372423 55/111 (50%)
PrkcshNP_001280579.1 PRKCSH-like 21..163 CDD:372423 54/107 (50%)
PLN02316 <169..>214 CDD:215180
FRQ1 <198..257 CDD:444056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..267
PRKCSH 380..>508 CDD:414904
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 525..528
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.