DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEOX1 and Ubx

DIOPT Version :9

Sequence 1:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:207 Identity:60/207 - (28%)
Similarity:82/207 - (39%) Gaps:69/207 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    91 SPNWHFPVSDARRRPNS------GPAGGS--KEMGTSSLGLVDTTGGPGDDYGV----------- 136
            :|....||..:...|:|      ..:|||  ...|.|:.|.|..:||.|:..||           
  Fly   146 NPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGT 210

Human   137 -------LGSTANETEKKSS-----------------------RRRKESSDNQE------NRGKP 165
                   :...|.:|...||                       .:.|..||..:      :.||.
  Fly   211 AWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKR 275

Human   166 EGSSKA--------------RKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVK 216
            ...|.|              |:.|..:|:.|..|||.||..::||||.||.|:|..|.|:|||:|
  Fly   276 YSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIK 340

Human   217 VWFQNRRMKWKR 228
            :||||||||.|:
  Fly   341 IWFQNRRMKLKK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 30/155 (19%)
Homeobox 175..227 CDD:306543 30/51 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 1/2 (50%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.