DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEOX1 and Scr

DIOPT Version :9

Sequence 1:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:313 Identity:77/313 - (24%)
Similarity:113/313 - (36%) Gaps:95/313 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     3 PAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCL 67
            |||::...:|.|..|      ..|.....|.|....|........:|..|...............
  Fly    77 PAAAAYTPNLYPNTP------QAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAH 135

Human    68 AATPHSLPQEEHIFTEQHP---------------------------------------------- 86
            ||...:..|::.:..:|||                                              
  Fly   136 AAAAVAAQQQQQLAQQQHPQQQQQQQQANISCKYANDPVTPGGSGGGGVSGSNNNNNSANSNNNN 200

Human    87 ----AFPQ-----------SPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVD------TTGGP 130
                |.||           ||:  ..|....|..|.|..|||.....::.||.:      .:|||
  Fly   201 SQSLASPQDLSTRDISPKLSPS--SVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGP 263

Human   131 GD-DYGVLGSTANETEKKSSRRRKESSDNQENRGK---PE----------GSS------KARKER 175
            |: :..:......:::.:|....:..|......||   |:          |:|      :.:::|
  Fly   264 GNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQR 328

Human   176 TAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKR 228
            |::|:.|..|||.||..:.||||.||.|||..|.|:|||:|:||||||||||:
  Fly   329 TSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 28/178 (16%)
Homeobox 175..227 CDD:306543 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 1/2 (50%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.