DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr37 and AT5G15550

DIOPT Version :9

Sequence 1:NP_650723.1 Gene:Wdr37 / 42218 FlyBaseID:FBgn0038617 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001332618.1 Gene:AT5G15550 / 831408 AraportID:AT5G15550 Length:433 Species:Arabidopsis thaliana


Alignment Length:298 Identity:69/298 - (23%)
Similarity:108/298 - (36%) Gaps:86/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GHKDGIWQVAA----KAGQPIIGTASADHTACIW------GVESARCLLQY---QGHAGSVNSIK 209
            ||...|..||.    .|....:.|||.|.|..::      .|:|...:..|   :||..||.|:.
plant   148 GHSGAISSVALVNSNDAETVTVATASKDRTLRLFKFDPAESVDSTTKVRAYKILRGHKASVQSVS 212

  Fly   210 FHQQRDLVLTGSGDGTAHIWQA--------AVNWEVPKKGHSSEEELDDSDEQVEDRDRVDTLRT 266
            ..:..::|.:.|.|.|.::|..        :|:.: .:||::..||.....|.|           
plant   213 AQKSGNMVCSSSWDCTINLWNTNESTSEGESVSVK-KRKGNNQAEESQSEGEAV----------- 265

  Fly   267 PLCEFTGPGGHLSVVVAADWLSSMDQIITGSWDRTAILWDVETG--------------------- 310
                 |...||...|.:..| ...|.|.:.|||.:...||||||                     
plant   266 -----TSLVGHTQCVSSVVW-PEHDVIYSSSWDHSVRRWDVETGKDSLNLFCGKALNTVDVGGES 324

  Fly   311 ------------------------LPLQPLTGHDHELTHVSAHPTQRL-VVTASRDTTFRLWDFR 350
                                    .|:...:.|...::....|.:... :::||.|....|||.|
plant   325 SALIAAGGSDPILRVWDPRKPGTSAPVFQFSSHSSWISACKWHKSSWFHLLSASYDGKIMLWDLR 389

  Fly   351 EAIPAVSVFQGHTETVTSSVFARDDKVVSGSDDRTIKV 388
            .|.| :||...|.:.|.|:.:.:.:.||||..|..:::
plant   390 TAWP-LSVIDTHNDKVLSADWWKGESVVSGGADSNLRI 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr37NP_650723.1 WD40 153..476 CDD:238121 69/298 (23%)
WD40 repeat 164..200 CDD:293791 11/48 (23%)
WD40 198..>481 CDD:225201 56/248 (23%)
WD40 repeat 205..274 CDD:293791 15/76 (20%)
WD40 repeat 282..317 CDD:293791 13/79 (16%)
WD40 repeat 323..360 CDD:293791 12/37 (32%)
WD40 repeat 366..403 CDD:293791 7/23 (30%)
WD40 repeat 407..430 CDD:293791
WD40 repeat 452..481 CDD:293791
AT5G15550NP_001332618.1 NLE 12..79 CDD:400462
WD40 109..426 CDD:238121 69/296 (23%)
WD40 repeat 154..203 CDD:293791 11/48 (23%)
WD40 repeat 208..269 CDD:293791 15/77 (19%)
WD40 repeat 276..310 CDD:293791 12/34 (35%)
WD40 repeat 315..353 CDD:293791 1/37 (3%)
WD40 repeat 361..399 CDD:293791 12/38 (32%)
WD40 repeat 404..426 CDD:293791 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19855
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.