DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdr37 and AT5G12920

DIOPT Version :10

Sequence 1:NP_650723.1 Gene:Wdr37 / 42218 FlyBaseID:FBgn0038617 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001154711.1 Gene:AT5G12920 / 831132 AraportID:AT5G12920 Length:572 Species:Arabidopsis thaliana


Alignment Length:127 Identity:25/127 - (19%)
Similarity:51/127 - (40%) Gaps:36/127 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 HDH----ELTHVSAHPTQRL--------------------VVTASRDTTF---------RLWDFR 350
            ||.    :::::|..||:.|                    .:|:..|:..         .:||.|
plant   247 HDQVLIFDISYMSPKPTEVLQTRQKLSIIGRKISRGLSDVAITSDEDSRIFSPDTLGMVHVWDRR 311

  Fly   351 EAI-PAVSVFQGHTETVTSSVFARDDKVVSGS-DDRTIKVWELRNMRSALA-TIRTDSSVNR 409
            ..: |.:.:.....:::.|.....|::.:.|: .:..|.:|:||..|::.| ..|.|.|:.|
plant   312 AGVSPCIELSTDRYDSIKSIQIYVDNQTIFGAGKEGIIHIWDLRGGRNSSAFQSRKDVSLTR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdr37NP_650723.1 WD40 153..476 CDD:238121 25/127 (20%)
WD40 repeat 164..200 CDD:293791
WD40 repeat 205..274 CDD:293791
WD40 repeat 282..317 CDD:293791
WD40 repeat 323..360 CDD:293791 10/66 (15%)
WD40 repeat 366..403 CDD:293791 9/38 (24%)
WD40 repeat 407..430 CDD:293791 1/3 (33%)
WD40 repeat 452..481 CDD:293791
AT5G12920NP_001154711.1 WD40 repeat 228..276 CDD:293791 6/28 (21%)
WD40 repeat 283..321 CDD:293791 6/37 (16%)
WD40 <297..>358 CDD:441893 11/60 (18%)
WD40 repeat 329..358 CDD:293791 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.