DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1b and VTI1

DIOPT Version :10

Sequence 1:NP_001138075.1 Gene:Vti1b / 42215 FlyBaseID:FBgn0264751 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_013924.1 Gene:VTI1 / 855237 SGDID:S000004810 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:34/109 - (31%)
Similarity:66/109 - (60%) Gaps:2/109 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SGSDQERRQAQLAASTYDVLQRTTDSIQRSNQIAIETENMGAEVLGELGEQRESLLRTTRRLEDA 75
            |..|.::||..|  |.:.:||::.|.::.:::||.|||.:|::::.:|..|||:|....:.|..|
Yeast   110 SNIDDDQRQQLL--SNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQA 172

  Fly    76 DQDLSKSRVIIRKLSREVLYNKIILILIIILEVGILVGLLVLKF 119
            |..:.||...::.::|.::.||.|...||.:.:.:::.:|..||
Yeast   173 DSYVDKSIKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1bNP_001138075.1 SNARE_Vti1b 27..88 CDD:277243 19/60 (32%)
VTI1NP_013924.1 V-SNARE 12..92 CDD:461516
SNARE_Vti1 127..185 CDD:277215 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.