DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1b and Vti1a

DIOPT Version :10

Sequence 1:NP_001138075.1 Gene:Vti1b / 42215 FlyBaseID:FBgn0264751 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_038945994.1 Gene:Vti1a / 65277 RGDID:621490 Length:229 Species:Rattus norvegicus


Alignment Length:119 Identity:34/119 - (28%)
Similarity:64/119 - (53%) Gaps:18/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SGSDQERR-------QAQLAASTYDVLQRTTDSIQRSNQIAIET-----ENMGAEVLGELGEQRE 63
            :|:..|.:       :|.|..:| :.|:|::..::...|||:||     :.:|.|:|..|...||
  Rat   107 AGNSSENQLIKLREERAHLLDNT-ERLERSSRRLEAGYQIAVETGKNSEKQIGQEMLENLSHDRE 170

  Fly    64 SLLRTTRRLEDADQDLSKSRVIIRKLSREVLYNKIILILIIILEVGILVGLLVL 117
            .:.|...||.:.|.:|.||..|:..:.|.::.|:|:|:::     ||:|.:.:|
  Rat   171 RIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVIL-----GIIVVITIL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1bNP_001138075.1 SNARE_Vti1b 27..88 CDD:277243 21/65 (32%)
Vti1aXP_038945994.1 V-SNARE 12..90 CDD:461516
SNARE_Vti1a 129..195 CDD:277244 22/66 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.