DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1b and Vti1a

DIOPT Version :10

Sequence 1:NP_001138075.1 Gene:Vti1b / 42215 FlyBaseID:FBgn0264751 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster


Alignment Length:118 Identity:31/118 - (26%)
Similarity:59/118 - (50%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YSQLPSGSDQERRQAQLAASTYDVLQRTTDSIQRSNQIAIETENMGAEVLGELGEQRESLLRTTR 70
            |..:...:||.:|    .....:.::||.:.:....::|:|||.:||:||.:|..|||:|.....
  Fly   111 YEDVSISTDQRQR----LLDNSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARA 171

  Fly    71 RLEDADQDLSKSRVIIRKLSREVLYNKIILI---LIIILEVGILVGLLVLKFA 120
            ||.:.:.:|.::...:..:....|..|::|.   :..::.||:   .|.|.||
  Fly   172 RLRETNAELGRASRTLNTMMLRALREKVVLYGVGVCFVVAVGV---SLYLTFA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1bNP_001138075.1 SNARE_Vti1b 27..88 CDD:277243 18/60 (30%)
Vti1aNP_612053.1 V-SNARE 11..89 CDD:461516
SNARE_Vti1a 128..189 CDD:277244 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.