DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1b and VTI1A

DIOPT Version :10

Sequence 1:NP_001138075.1 Gene:Vti1b / 42215 FlyBaseID:FBgn0264751 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001305132.1 Gene:VTI1A / 143187 HGNCID:17792 Length:224 Species:Homo sapiens


Alignment Length:103 Identity:35/103 - (33%)
Similarity:61/103 - (59%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QERRQAQLAASTYDVLQRTTDSIQRSNQIAIETENMGAEVLGELGEQRESLLRTTRRLEDADQDL 79
            :||  |.|..:| :.|:|::..::...|||:|||.:|.|:|..|...||.:.|...||.:.|.:|
Human   120 EER--AHLLDNT-ERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANL 181

  Fly    80 SKSRVIIRKLSREVLYNKIILILIIILEVGILVGLLVL 117
            .||..|:..:.|.::.|:|:|:::     ||:|.:.:|
Human   182 GKSSRILTGMLRRIIQNRILLVIL-----GIIVVITIL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1bNP_001138075.1 SNARE_Vti1b 27..88 CDD:277243 22/60 (37%)
VTI1ANP_001305132.1 V-SNARE 12..90 CDD:461516
SNARE_Vti1a 129..190 CDD:277244 23/61 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.