DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14309 and GUS3

DIOPT Version :9

Sequence 1:NP_650718.2 Gene:CG14309 / 42212 FlyBaseID:FBgn0038611 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_851093.1 Gene:GUS3 / 833437 AraportID:AT5G34940 Length:536 Species:Arabidopsis thaliana


Alignment Length:334 Identity:65/334 - (19%)
Similarity:128/334 - (38%) Gaps:112/334 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 VDDWRL--------MGADISAGSSADETKRYVDMSKDLNTAFGWTQPANML-------------- 215
            :|.|.|        :||.:.|...|.:|   :::...:|..:....|..::              
plant   194 IDGWELGNELCGSGVGARVGANQYAIDT---INLRNIVNRVYKNVSPMPLVIGPGGFFEVDWFTE 255

  Fly   216 ----PKSSLGS---YLYDSDPAL--RTLQQQRVPLWLTLPEE--RSSQRLVGDETTDALRWAQTM 269
                .::||.:   ::||..|.:  ..:::...|.:|....:  ||.:.::.:.:|.|:.|....
plant   256 YLNKAENSLNATTRHIYDLGPGVDEHLIEKILNPSYLDQEAKSFRSLKNIIKNSSTKAVAWVGES 320

  Fly   270 GDAAASGFDVI----------------------------------FKRMNLVDFERPNFSLYVTA 300
            |.|..||.:::                                  :..:|..:| .||...|...
plant   321 GGAYNSGRNLVSNAFVYSFWYLDQLGMASLYDTKTYCRQSLIGGNYGLLNTTNF-TPNPDYYSAL 384

  Fly   301 LFKKVMGSRVFPARPLNAFAPSNKL--YTHCANAVSGGLAFMVVNTEEQPTTIT-VKSTSSLS-- 360
            :::::||.:..    ...|:.:.|:  |||||.. |.|:..:::|.:...|.:. |:..:|.|  
plant   385 IWRQLMGRKAL----FTTFSGTKKIRSYTHCARQ-SKGITVLLMNLDNTTTVVAKVELNNSFSLR 444

  Fly   361 -----------SSEIW----------QYVLTG-----HDQRVQLNNVRLHLNT--TLRPLIKP-- 395
                       ||:::          :|.||.     |.|.:.||...|.:|:  .|.| |:|  
plant   445 HTKHMKSYKRASSQLFGGPNGVIQREEYHLTAKDGNLHSQTMLLNGNALQVNSMGDLPP-IEPIH 508

  Fly   396 IDPTKPLQL 404
            |:.|:|:.:
plant   509 INSTEPITI 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14309NP_650718.2 None
GUS3NP_851093.1 Glyco_hydro_79n 31..346 CDD:281637 26/154 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.