DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14309 and GUS2

DIOPT Version :9

Sequence 1:NP_650718.2 Gene:CG14309 / 42212 FlyBaseID:FBgn0038611 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_196400.2 Gene:GUS2 / 830676 AraportID:AT5G07830 Length:543 Species:Arabidopsis thaliana


Alignment Length:397 Identity:83/397 - (20%)
Similarity:136/397 - (34%) Gaps:119/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 WDSMHTLKILNTSYMVGITDCIWQLGTDFGTS------RAKDYVQELRTLKLMTD-------TFK 170
            ||.::|...||.:...|.....|:.|.:...|      .|:.|.::|..||.:.:       ..|
plant   174 WDHINTQDFLNYTVSKGYVIDSWEFGNELSGSGVGASVSAELYGKDLIVLKDVINKVYKNSWLHK 238

  Fly   171 P--------YVDDWRLMGADISAGSSADETKRYVDMSKDLNTAFGWTQPANMLPKSSLGSYLYDS 227
            |        |...|.....:||..|..|....::     .|...| ..|| ::.|....|||...
plant   239 PILVAPGGFYEQQWYTKLLEISGPSVVDVVTHHI-----YNLGSG-NDPA-LVKKIMDPSYLSQV 296

  Fly   228 DPALRTLQQQRVPLWLTLPEE---------------RSSQRLVGDETTDALRWAQTMGDAA---- 273
            ....:.:.|       |:.|.               .|..|.|.|...|:..:...:|.:|    
plant   297 SKTFKDVNQ-------TIQEHGPWASPWVGESGGAYNSGGRHVSDTFIDSFWYLDQLGMSARHNT 354

  Fly   274 --------ASGFDVIFKRMNLVDFERPNFSLYVTALFKKVMGSRVFPAR---PLNAFAPSNKLYT 327
                    ..||..:.::...|    ||...|...|:.::||..|...:   |     |..::|.
plant   355 KVYCRQTLVGGFYGLLEKGTFV----PNPDYYSALLWHRLMGKGVLAVQTDGP-----PQLRVYA 410

  Fly   328 HCANAVSGGLAFMVVNTEEQPT-TITV-------------KSTSSLSSSE---IW---------- 365
            ||:.. ..|:..:::|...|.. |::|             |..|.|.:.:   .|          
plant   411 HCSKG-RAGVTLLLINLSNQSDFTVSVSNGINVVLNAESRKKKSLLDTLKRPFSWIGSKASDGYL 474

  Fly   366 ---QYVLTGHD-----QRVQLNNVRLHLNTT-----LRPLIKPIDPTKPLQLITPSMAVSFWVLP 417
               :|.||..:     :.:.||...|....|     |.|:::.::  .||.::..||  ||.|||
plant   475 NREEYHLTPENGVLRSKTMVLNGKSLKPTATGDIPSLEPVLRSVN--SPLNVLPLSM--SFIVLP 535

  Fly   418 DVNLEHC 424
            :.:...|
plant   536 NFDASAC 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14309NP_650718.2 None
GUS2NP_196400.2 Glyco_hydro_79n 29..347 CDD:397637 38/186 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.