DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and CBR1

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001748.1 Gene:CBR1 / 873 HGNCID:1548 Length:277 Species:Homo sapiens


Alignment Length:269 Identity:62/269 - (23%)
Similarity:116/269 - (43%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IITGANSGIGKETAKDLAGR-GARIIMACRNLETANAVKDEIVKETKNNKILVKKLDLGSQKSVR 119
            ::||.|.|||....:||... ...:::..|::....|...::..|..:.:.  .:||:...:|:|
Human     9 LVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRF--HQLDIDDLQSIR 71

  Fly   120 EFAADIVKTEPKIDVLIHNAGMALAFRGQTS-EDGVELTMATNHYGPFLLTHLLIDVLKKSAPAR 183
            .....:.|....:|||::|||:|......|. ....|:||.||.:|...:...|:.::|..  .|
Human    72 ALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQ--GR 134

  Fly   184 IVIVAS---------------ELYRLSSVNLAKLNPIGT-----------------FPAAYLYYV 216
            :|.|:|               :.:|..::...:|  :|.                 :|:: .|.|
Human   135 VVNVSSIMSVRALKSCSPELQQKFRSETITEEEL--VGLMNKFVEDTKKGVHQKEGWPSS-AYGV 196

  Fly   217 SK-----FANIYFARELAKRLEGTKVTVNFLHPGMIDSGIWRNVPFPLNLPMMAITKGFFKTTKA 276
            :|     .:.|: ||:|:::.:|.|:.:|...||.:.:.             ||..|. .|:.:.
Human   197 TKIGVTVLSRIH-ARKLSEQRKGDKILLNACCPGWVRTD-------------MAGPKA-TKSPEE 246

  Fly   277 GAQTTIYLA 285
            ||:|.:|||
Human   247 GAETPVYLA 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 62/269 (23%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 62/269 (23%)
CBR1NP_001748.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 62/269 (23%)
Glutathione binding 95..97 0/1 (0%)