DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7675 and ENV9

DIOPT Version :9

Sequence 1:NP_001287390.1 Gene:CG7675 / 42211 FlyBaseID:FBgn0038610 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_014889.3 Gene:ENV9 / 854420 SGDID:S000005772 Length:330 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:82/323 - (25%)
Similarity:137/323 - (42%) Gaps:60/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FTETKMEGKTVIITGANSGIGKETAKDLAGRGARIIMACRNLETANAVKDEIVKETKN------- 102
            :.:..:|.|..::||.|:|||..|...|...|..:.:..||....:....||:.|.|.       
Yeast     9 YYDPAVERKIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDD 73

  Fly   103 ---------------NKILVKKLDLGSQKSVREFAADIVKTEPKIDVLIHNAGMALAFRGQTSED 152
                           ..:....|||...|.|...|..|:|.|..||||::|||: :|...:.::|
Yeast    74 GSSPGAGPGPSIQRLGSLHYIHLDLTDLKCVERAALKILKLEDHIDVLVNNAGI-MAVPLEMTKD 137

  Fly   153 GVELTMATNHYGPFLLTHLLIDVLKKSAPARIVIVAS-------ELYRLSSVNLAKLNPIGTFPA 210
            |.|:.:.||:...|:.|..|:.:| :....||:.::|       ..::||.....|.|.:.|:  
Yeast   138 GFEVQLQTNYISHFIFTMRLLPLL-RHCRGRIISLSSIGHHLEFMYWKLSKTWDYKPNMLFTW-- 199

  Fly   211 AYLYYVSKFANIYFARELAKRLEGTKVTVNFLHPGMIDS----GIWRNVPFPLNLPMMAI----- 266
             :.|.:||.|.|...:.||  ::...|....:|||::.:    ..|      ..||::.|     
Yeast   200 -FRYAMSKTALIQCTKMLA--IKYPDVLCLSVHPGLVMNTNLFSYW------TRLPIVGIFFWLL 255

  Fly   267 --TKGFF--KTTKAGAQTTIYLA--TSNEVANVSGKYF-MDCKEATLNAAA--LDEEKGLKIW 320
              ..|||  .:.:.|:..::..|  .:..|...:|||| ...||:..:..:  :||.....||
Yeast   256 FQVVGFFFGVSNEQGSLASLKCALDPNLSVEKDNGKYFTTGGKESKSSYVSNNVDEAASTWIW 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7675NP_001287390.1 PRK06196 52..327 CDD:235736 81/316 (26%)
retinol-DH_like_SDR_c_like 52..320 CDD:212492 79/314 (25%)
ENV9NP_014889.3 NADB_Rossmann 17..318 CDD:419666 79/313 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm46796
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.